DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AKR1B15

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:349 Identity:87/349 - (24%)
Similarity:134/349 - (38%) Gaps:82/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGLQVS--KVSFGGGALCANYGFDLEEGIKTVHEAVKSGIN----YIDTAPWYGQGRSEEVLGLA 88
            |||:.|  |.:...|.|...|...|   :..|.||||..|:    :||.|.:|   .::..:|.|
Human    28 TGLKSSLLKDTTSAGPLLRPYPASL---LGKVKEAVKVAIDAEYRHIDCAYFY---ENQHEVGEA 86

  Fly    89 L------KDVPRESYYIATKVARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH---- 143
            :      |.|.||..:|.:||      :...|:  ....|::.||:||.|.|.|:||..||    
Human    87 IQEKIQEKAVMREDLFIVSKV------WPTFFE--RPLVRKAFEKTLKDLKLSYLDVYLIHWPQG 143

  Fly   144 ----DIEFAKD------------LDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTA 192
                |..|.||            ||     ....:|:||.||..:.:|||.:....::..|.:..
Human   144 FKTGDDFFPKDDKGNMISGKGTFLD-----AWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPG 203

  Fly   193 GRLDTVLTYARYT--------LTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPWHPASD 249
                  |.|...|        ||.|.|::|     ..:.|:...|...||    :..:||....|
Human   204 ------LKYKPVTNQVECHPYLTQEKLIQY-----CHSKGITVTAYSPLG----SPDRPWAKPED 253

  Fly   250 EQKAIARKASEV-CKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQ 313
            .......|..|: .|.:......|..::....:..:...:|.....:    |:...:..|||:|.
Human   254 PSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVE----NIQVFDFKLSDEEM 314

  Fly   314 EVLRYLKENVLTKPFDW-EGNELE 336
            ..:.....|  .:.||: |.:.||
Human   315 ATILSFNRN--WRAFDFKEFSHLE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 84/342 (25%)
Aldo_ket_red 24..321 CDD:294321 81/331 (24%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 73/305 (24%)
Tas 57..317 CDD:223739 71/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.