DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c19

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001013807.2 Gene:Akr1c19 / 432720 MGIID:2653678 Length:323 Species:Mus musculus


Alignment Length:314 Identity:78/314 - (24%)
Similarity:126/314 - (40%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDY 110
            ::.:|.|:::|..:||||..|   ::|..:|.|::.      |.||..::.||:    .|.||  
Mouse    35 LEAIHLALEAGFRHIDTAYVY---QTENHVGQAIRSKIAAGLVKREDIFLTTKLWCTFHRPEL-- 94

  Fly   111 DKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH-------------DIEFAKDL-DIV-INETLP 160
                      .|.::|||||.|.|||.|:..||             :.|..|.| |.| |..|..
Mouse    95 ----------VRSNLEKSLKNLQLDYADLYLIHYPVQMKPGEDLFPEDEHGKTLFDTVDICATWE 149

  Fly   161 TLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQNL 223
            .:|:....|..:.||||.:....|::.|.:...:...|...  ....|....||.|.   ||:: 
Mouse   150 AMEKCKDAGLVKSIGVSNFNSRQLEKILNKPGLKYKPVCNQVECHLYLNQRKLLNYC---KSKD- 210

  Fly   224 GVICAAAHALGLLTNAGPQPW-HPAS----------DEQKAIARKASEVC----KERGVELGKLA 273
             ::..|..|||   :..|:.| .|:|          |..|...|..:::.    .:||:.:  ||
Mouse   211 -IVLVAYCALG---SQRPKRWVDPSSPVLLNDPILCDMAKKHKRSPAQIALRYHLQRGIVV--LA 269

  Fly   274 MYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKP 327
            ..|..:.:.|                |:...|..|..::.::|..|..|:...|
Mouse   270 QSYKENEIKE----------------NIQVFEFELPSEDMKILDSLDRNLRYAP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 78/314 (25%)
Aldo_ket_red 24..321 CDD:294321 76/306 (25%)
Akr1c19NP_001013807.2 ARA1 8..307 CDD:223729 77/312 (25%)
Tas 11..310 CDD:223739 78/314 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.