DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and CG10638

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster


Alignment Length:244 Identity:60/244 - (24%)
Similarity:92/244 - (37%) Gaps:81/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NYGFDL------------EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VP 93
            |.|:::            .||...|..|:..|..:||||.:|   ::|..:|.|::|      |.
  Fly    10 NNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFY---QNEAEVGKAIRDKIAEGVVK 71

  Fly    94 RESYYIATKVARYELDYDKMFDFSAKKTRESVE----KSLKLLGLDYVDVIQIH----------- 143
            ||..::.||:  :.:.:|.          |.||    |.|...||||:|:..:|           
  Fly    72 REDIFLVTKL--WNIFHDP----------ERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDN 124

  Fly   144 --------DIEFAKDLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTR-----TAGRL 195
                    |:....|:|.:  :|...:|:|||.|..|.||||.:....|...|..     ...::
  Fly   125 TLLPKNEDDVLQLSDVDYL--DTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQV 187

  Fly   196 DTVLTYARYTLT------DETLLEYL------------DFFKSQNLGVI 226
            :......:..||      |.||..|.            ||..|..:.||
  Fly   188 ECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 60/244 (25%)
Aldo_ket_red 24..321 CDD:294321 60/244 (25%)
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 60/244 (25%)
Tas 5..297 CDD:223739 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.