DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c12

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:316 Identity:79/316 - (25%)
Similarity:126/316 - (39%) Gaps:64/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKVARYELDYDK 112
            :.::..|.|:..|..:||||..|   :.||.:|.|::.      |.|:..:|.||:        .
  Rat    33 KSLEAAHLAIDVGYRHIDTASAY---QVEEEIGQAIQSKIKAGVVKRKDMFITTKL--------W 86

  Fly   113 MFDFSAKKTRESVEKSLKLLGLDYVDVIQIH---DIEFAKD-----------LDIV-INETLPTL 162
            ...|..:..|.::|||||.|.|||||:..||   .|:.:.|           ||.| ..:|...|
  Rat    87 CSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDESPLDEKGKFLLDTVDFCDTWEML 151

  Fly   163 EQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQNLGVI 226
            |:....|..:.||||.:....|:..|.:...:...|..... :...:::.|  ||:.||:::.::
  Rat   152 EKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKL--LDYCKSKDIVLV 214

  Fly   227 CAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVC-----KERGVELGKLAMYYTMSGLPEVST 286
                 |.|.|   |.|.:....|:...:......:|     .:|...|..|...:....:|...:
  Rat   215 -----AYGAL---GTQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIALRYLFQRGVVPLAQS 271

  Fly   287 FLTGMQTRQLLRINLDANEVGLSDKEQEVL-------RYLKENVLTK----PFDWE 331
            |     ....:|.||...|..||.::.:.|       |||....|..    ||..|
  Rat   272 F-----KENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLADHPEYPFSEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 78/314 (25%)
Aldo_ket_red 24..321 CDD:294321 75/300 (25%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 72/297 (24%)
Tas 16..297 CDD:223739 71/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.