DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c15

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:304 Identity:77/304 - (25%)
Similarity:123/304 - (40%) Gaps:91/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDYDKMFDF 116
            |:..|..:||.|.:|   ::||.:|.||:|      |.||..:..||:    .|.||        
  Rat    42 AIDVGFRHIDAAYFY---QNEEEVGQALRDKMADGTVKREDLFYTTKIWITFLRPEL-------- 95

  Fly   117 SAKKTRESVEKSLKLLGLDYVDVIQIHDIEFA---------KDLD-------IVINETLPTLEQL 165
                .|:.:|:|||.|||||||:..|| |..|         ||.:       :.|.:|...||:.
  Rat    96 ----VRQCLERSLKKLGLDYVDLCIIH-IPIAMKPGEELLPKDANGKFIFDTVDIRDTWEALEKC 155

  Fly   166 VKEGKARFIGVSAYPISVLKEFLTR-------TAGRLDTVLTYARYTLTDETLLEYLDFFKSQNL 223
            ...|.::.||||.:....|:..|.:       |..:::     ....|....|||   |.||:: 
  Rat   156 KDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVE-----CHPYLNQSKLLE---FCKSKD- 211

  Fly   224 GVICAAAHALGLLTNAGPQPWHPASDEQKAIARKA-SEVCKERGVELGKLAMYYTMSGLPEVSTF 287
             ::..|..|||...::.   | .:||....:.... ..:.|:.....|::|:.|.:.        
  Rat   212 -IVLVAYSALGSHRDSS---W-VSSDSPYLLEDPVLMTIAKKHNQTPGQVALRYQLQ-------- 263

  Fly   288 LTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDWE 331
                  |.::.:....||           :.:|||.  :.||:|
  Rat   264 ------RGVVVLAKSFNE-----------KRIKENF--QVFDFE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 76/302 (25%)
Aldo_ket_red 24..321 CDD:294321 71/292 (24%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 77/304 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.