DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c13

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c13 / 361266 RGDID:1308232 Length:371 Species:Rattus norvegicus


Alignment Length:320 Identity:79/320 - (24%)
Similarity:129/320 - (40%) Gaps:72/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYEL 108
            :.::..|.|:.:|..:||||..|   :.||.:|.|::.      |.||..:|.||:    .|.||
  Rat    81 KSLEAAHLAIDAGYRHIDTAYAY---QIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPEL 142

  Fly   109 DYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKD------LDIV-INET 158
                        .:.::|||||.|.|||.|:..:|        |.:|..|      ||.| ..:|
  Rat   143 ------------VKPALEKSLKNLQLDYADLYIMHYPVPMKSGDNDFPVDEKGKSLLDTVDFCDT 195

  Fly   159 LPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQN 222
            ...||:....|..:.||||.:....|:..|.:...:...|..... :...:::.|  ||:.||::
  Rat   196 WEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKL--LDYCKSKD 258

  Fly   223 LGVICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVC---KERGVELGKLAMYYTMSG--LP 282
            :.::     |.|.|   |.|.:....|:...:......:|   |:.......:|:.|.:..  :|
  Rat   259 IVLV-----AYGAL---GTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVP 315

  Fly   283 EVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVL-------RYLKENVLT----KPFDWE 331
            ...:|     ....:|.||...:..||.::.:.|       |||....|.    .||..|
  Rat   316 LAQSF-----KENEMRENLQVFDFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPFSEE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 78/318 (25%)
Aldo_ket_red 24..321 CDD:294321 75/304 (25%)
Akr1c13XP_006254252.1 Tas 77..345 CDD:223739 71/293 (24%)
ARA1 89..353 CDD:223729 71/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.