DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Hk

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster


Alignment Length:169 Identity:47/169 - (27%)
Similarity:79/169 - (46%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HDEAKVRRMEYRNLGKTGLQVSKVSFGGGALCA-NYGFDLEEGIKTVHEAVKSGINYIDTAPWYG 77
            |.......:.|:||||:||::|.|..|...:.: ....|..|.|..:  |::||||..|.:    
  Fly   195 HGSTPTPGLRYKNLGKSGLRISNVGLGTWPVFSPGVSDDQAEAILKL--AIESGINLFDIS---- 253

  Fly    78 QGRSEEVLGLALKDV--PRESYYIATKVARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVI 140
            :..||..:|..|:..  .|.:|.|.|||  |.....:....|.|...|.|..||:.|.|.|:|::
  Fly   254 EAHSETEIGKILQRAGWKRTAYVITTKV--YWSTKSEERGLSRKHIIECVRASLQRLQLQYIDIV 316

  Fly   141 QIHDIEFAKDLDIVINETLPTLEQLVKEGKARFIGVSAY 179
            .||..:....:::|     ..:..::::|.|.:.|.:.:
  Fly   317 IIHKADPMCPMEVV-----RAMSYVIQQGWAMYWGTARW 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 46/161 (29%)
Aldo_ket_red 24..321 CDD:294321 46/159 (29%)
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 46/159 (29%)
Aldo_ket_red 218..531 CDD:278668 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51451
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.