DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c19

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001094046.1 Gene:Akr1c19 / 307096 RGDID:1562954 Length:323 Species:Rattus norvegicus


Alignment Length:312 Identity:79/312 - (25%)
Similarity:126/312 - (40%) Gaps:79/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDY 110
            ::.:|.||::|..:||||..|   ::|..:|.|:|.      |.||..:|.||:    .|.|:  
  Rat    35 LEAIHLAVEAGFRHIDTAYVY---QTENHVGQAIKSKIAAGIVKREDIFITTKLWCTFHRPEM-- 94

  Fly   111 DKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKD------LDIV-INETLP 160
                      ...|:|||||.|.|||||:..||        :..|.:|      .|.| :..|..
  Rat    95 ----------VLSSLEKSLKNLQLDYVDLYIIHYPMQMKSGEDMFPEDENGKTLFDTVDLCATWE 149

  Fly   161 TLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQNL 223
            .:|:....|.|:.||||.:....|::.|.:...:...|...  ....|....||.|.   ||:: 
  Rat   150 AMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLYLNQSKLLNYC---KSRD- 210

  Fly   224 GVICAAAHALGLLTNAGPQPW-HPAS----------DEQKAIARKASEVCKERGVELGK--LAMY 275
             ::..|..|||   :..|:.| .|:|          |..|...|.::::.....::.|.  ||..
  Rat   211 -IVLVAYCALG---SQRPKRWVDPSSPVLLNDPVLCDVAKKHQRSSAQIALRYQLQRGNVVLAQS 271

  Fly   276 YTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKP 327
            |..:.:.|                |:...|..|..::.::|..|..|:...|
  Rat   272 YKENEIKE----------------NIQVFEFELPSEDMKILDSLDRNLRYAP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 79/312 (25%)
Aldo_ket_red 24..321 CDD:294321 77/304 (25%)
Akr1c19NP_001094046.1 AKR_AKR1C1-35 6..308 CDD:381334 79/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.