DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c1

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001028869.1 Gene:Akr1c1 / 307092 RGDID:1306847 Length:323 Species:Rattus norvegicus


Alignment Length:306 Identity:77/306 - (25%)
Similarity:127/306 - (41%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKVARYELDYDKMFDFS-AK 119
            |:.:|..:||:|..|   ::|:.:|||::.      |.||..:..:||         ...|: .:
  Rat    41 AIDAGFRHIDSAAVY---QNEKEVGLAIRSKIADGTVKREDIFYTSKV---------WCTFNHPE 93

  Fly   120 KTRESVEKSLKLLGLDYVDVIQIH---------DIEFAKD------LDIV-INETLPTLEQLVKE 168
            :.:..:|:|||.|.|:|||:..||         |:: |||      .|:| |.:|...:|:....
  Rat    94 RVQVCLEQSLKQLQLEYVDLYLIHFPMALKPEEDLK-AKDENEKLLFDVVDICDTWKAMEKCKDA 157

  Fly   169 GKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQNLGVICAAAHA 232
            |.|:.||||.:....|::.|.:...:...|..... :...::..|  |||.||::  ::..|..|
  Rat   158 GLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVECHPYLNQRKL--LDFCKSKD--IVLVAYSA 218

  Fly   233 LG--------------------LLTNAGPQPWHPASDEQKAIARKASEVCKERGVELGKLAMYYT 277
            ||                    |...|....|.||     .||.:..   .||||.:  ||..:|
  Rat   219 LGSHRETRCVDKSLPVLLADPVLCAIAKKYNWTPA-----LIALRYQ---LERGVVV--LAKSFT 273

  Fly   278 MSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENV 323
            ...:.|                |:...|..|:.::.:||..|.:|:
  Rat   274 EKRIKE----------------NMQVFEFQLTSEDMKVLDGLNKNI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 77/306 (25%)
Aldo_ket_red 24..321 CDD:294321 76/302 (25%)
Akr1c1NP_001028869.1 ARA1 5..305 CDD:223729 77/306 (25%)
Tas 16..297 CDD:223739 74/298 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.