DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Kcnab2

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_017448703.1 Gene:Kcnab2 / 29738 RGDID:61828 Length:383 Species:Rattus norvegicus


Alignment Length:356 Identity:84/356 - (23%)
Similarity:153/356 - (42%) Gaps:69/356 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YRNLGKTGLQVSKVSFG-----GGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRSEE 83
            ||||||:||:||.:..|     ||.:..    ::.|.:.|:  |..:|||..|||..|..|::|.
  Rat    39 YRNLGKSGLRVSCLGLGTWVTFGGQITD----EMAEHLMTL--AYDNGINLFDTAEVYAAGKAEV 97

  Fly    84 VLG--LALKDVPRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH 143
            |||  :..|...|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.|.|:||||:   
  Rat    98 VLGNIIKKKGWRRSSLVITTKIFWGGKAETER----GLSRKHIIEGLKASLERLQLEYVDVV--- 155

  Fly   144 DIEFA------------------KDLDIVINETLPTLEQLVKEGKARFIGVSAY-PISVLKEF-L 188
               ||                  |....:|.||:..:..::.:|.|.:.|.|.: .:.:::.: :
  Rat   156 ---FANRPDPNTPMEAGDPFSSFKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSV 217

  Fly   189 TRTAGRLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT---NAGPQPWHPAS 248
            .|....:..:...|.|.:  .::..::..:.|....:|.:..:..|.|:::   ::|..|:..||
  Rat   218 ARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRAS 282

  Fly   249 ----------------DEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLL 297
                            ..|:|..::...:.:..|..|.:||:.:.:.. ..||:.|.|....:.|
  Rat   283 LKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRN-EGVSSVLLGASNAEQL 346

  Fly   298 RINLDANEVGLSDKEQEVLRYLKENVLTKPF 328
            ..|:.|.:| |......::..:...:..||:
  Rat   347 MENIGAIQV-LPKLSSSIVHEIDSILGNKPY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 84/356 (24%)
Aldo_ket_red 24..321 CDD:294321 82/347 (24%)
Kcnab2XP_017448703.1 Aldo_ket_red_shaker 38..363 CDD:381367 82/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5200
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.