DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c2

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006254245.1 Gene:Akr1c2 / 291283 RGDID:1311841 Length:323 Species:Rattus norvegicus


Alignment Length:287 Identity:69/287 - (24%)
Similarity:121/287 - (42%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKVARYELDYDKMFDFSAKK 120
            |:.:|.::.|:|..|   .:|:.:|.|:::      ..||..:..:|:....|        ..:.
  Rat    41 AIDAGFHHFDSAFVY---NTEDHVGEAIREKIANGTTRREDIFYTSKLWCTSL--------HPEL 94

  Fly   121 TRESVEKSLKLLGLDYVDVIQIH--------DIEFAKD------LDIV-INETLPTLEQLVKEGK 170
            .|.|:|.|||.|.|||||:..||        |..|..|      .|.| :..|...:|:....|.
  Rat    95 VRSSLECSLKKLQLDYVDLYLIHFPMALKPGDENFPVDEHGKLLFDTVDLCATWEAMEKCKDAGL 159

  Fly   171 ARFIGVSAYPISVLKEFLTRTAGRLDTVLTYARYTLTDETLLEYLDFFKSQNLGVICAAAHALGL 235
            |:.||||.:....|::.|.:...:...|.......|. ...::.|||.|:.  |:|..   |.|:
  Rat   160 AKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLY-LNQMKLLDFCKTN--GIILV---AYGV 218

  Fly   236 LTNAGPQPWHPASDEQKAIARK---ASEVCKERGVELGKLAMYYTMS-GLPEVSTFLTGMQTRQL 296
            |   |.|.::...|:...:...   .|.:.|:.......:|:.:.:. |:..::|.|    ..:.
  Rat   219 L---GTQRYNGWVDQNSPVLLNEPVLSSMAKKYNQTPALIALRHQLQRGIVVLNTSL----KEER 276

  Fly   297 LRINLDANEVGLSDKEQEVLRYLKENV 323
            ::.|:...|..||.::.:||..|..|:
  Rat   277 IKENMKVFEFQLSPEDMKVLDDLNRNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 69/287 (24%)
Aldo_ket_red 24..321 CDD:294321 68/283 (24%)
Akr1c2XP_006254245.1 AKR_AKR1C1-35 6..308 CDD:381334 69/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.