DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c13

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:301 Identity:73/301 - (24%)
Similarity:118/301 - (39%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDYDKMFDF 116
            |:..|..::|||..|   :.||.:|.|::.      |.||..:|.||:    .|.||        
Mouse    42 ALDVGYRHVDTAYAY---QVEEEIGQAIQSKIKAGVVKREDLFITTKLWCTCFRPEL-------- 95

  Fly   117 SAKKTRESVEKSLKLLGLDYVDVIQIHDIEFAK--DLDIVINE-------------TLPTLEQLV 166
                .:.::|||||.|.|||||:..:|.....|  |.|..:||             |...||:..
Mouse    96 ----VKPALEKSLKKLQLDYVDLYIMHYPVPMKSGDNDFPVNEQGKSLLDTVDFCDTWERLEECK 156

  Fly   167 KEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQNLGVICAA 229
            ..|..:.||||.:....|:..|.:...:...|...  ....|....||:|.:   |:::.::   
Mouse   157 DAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCE---SKDIVLV--- 215

  Fly   230 AHALGLLTNAGPQPWHPASDEQKAIARKASEVC---KERGVELGKLAMYYTMSG--LPEVSTFLT 289
              |.|.|   |.|.:....|:...:......:|   |:.......:|:.|.:..  :|...:|  
Mouse   216 --AYGAL---GTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVPLAQSF-- 273

  Fly   290 GMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDW 330
               ....:|.||......||.::.:.|..|.:|....|.::
Mouse   274 ---KENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 73/301 (24%)
Aldo_ket_red 24..321 CDD:294321 71/290 (24%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 72/297 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.