DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and SPAC977.14c

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_592785.1 Gene:SPAC977.14c / 2543325 PomBaseID:SPAC977.14c Length:351 Species:Schizosaccharomyces pombe


Alignment Length:363 Identity:99/363 - (27%)
Similarity:154/363 - (42%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YRNLGKTGLQVSKVSFGGGALCANYG----------FDLEEGIKTVHEAVKSGINYIDTAPWYGQ 78
            |..||.:||:|||:..|    |.:||          .|.||..|.:..|..:||...|||..|..
pombe     9 YGCLGNSGLKVSKLILG----CMSYGKKEYWEDWVLEDEEEVFKIMKAAYDAGIRTFDTANCYSA 69

  Fly    79 GRSEEVLGLALK--DVPRESYYIATK----VARYELDYDKMF--------------------DFS 117
            |.|||::|..::  ::||.|..|.:|    |.:   |..|:|                    ..|
pombe    70 GVSEELVGKFIRKYEIPRSSIVILSKCFFPVRK---DLIKIFGDLSSRGVHFLDSPELANQCGLS 131

  Fly   118 AKKTRESVEKSLKLLGLDYVDVIQIHDIEFAKDLDIVINETLPTLEQLVKEGKARFIGVSAYPIS 182
            .|...::||.|:|.|| .|:||:|||    ..|..:...|.:..|..:|:.||.|:||.|.....
pombe   132 RKHIFDAVEDSVKRLG-TYIDVLQIH----RYDPHVSAEEVMRALNDVVESGKVRYIGASTMRCY 191

  Fly   183 VLKEFLTRTAGR--LDTVLTYARY--TLTDETLLEYLDFFKSQNLGVICAAAHALGLLT---NAG 240
            ...| |..||.:  ....::...|  .|..|...|.:.:.:...:|:|..:..|.||||   :|.
pombe   192 QFIE-LQNTAEKHGWHKFISMQNYHNLLYREEEREMIPYCQKTGVGLIPWSPLARGLLTRSIDAN 255

  Fly   241 PQPWHPASD----------EQKAIARKASEVCKERGVELGKLAMYYTM--SGLPEVSTFLTGMQT 293
            .:.....:|          ..|||..:..|:.|:..|.:..||..:::  ...|     :.|:..
pombe   256 EETIRSKTDLYTRALEFGAGYKAILSRVEELAKKYNVSMATLATAWSLHKGDYP-----IVGISK 315

  Fly   294 RQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDWE 331
            .:.|:..|.|.|:.||:::   ::||:|.....|...|
pombe   316 VERLKDALAAVELKLSEED---IKYLEEPYCPVPIQGE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 98/361 (27%)
Aldo_ket_red 24..321 CDD:294321 96/351 (27%)
SPAC977.14cNP_592785.1 Tas 12..342 CDD:223739 96/350 (27%)
Aldo_ket_red 12..340 CDD:119408 95/348 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1741
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.