DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and ARY

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster


Alignment Length:345 Identity:74/345 - (21%)
Similarity:144/345 - (41%) Gaps:64/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KTGLQVSKVSFGGGALCANYGFDLEE--GIK---TVHEAVKSGINYIDTAPWYGQGRSEEVLGLA 88
            |..|...||....|......||...:  |.:   .||.|:::|..:.|||.:|   .:|:.:|.|
  Fly    33 KALLMAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYY---ENEKEIGEA 94

  Fly    89 LK------DVPRESYYIATKVARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH---D 144
            |:      ::.||:.::.||:  :...:|      .:..|...||.|:|||..|:|:..:|   .
  Fly    95 LRTQIKMGNISRENIFLTTKL--WNTHHD------PRDVRRICEKQLELLGFSYIDLYLMHFPVG 151

  Fly   145 IEFAKD-------------LDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGR-- 194
            .::..|             ::|...:|...:|.|||.|..|.||:|.:.:..::..:..::.:  
  Fly   152 YKYVCDEILMPMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPV 216

  Fly   195 LDTVLTYARYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPWHPASDEQKAIARK-- 257
            ::.|..:..:...|  |::|..:     .|:|..|...||........|.:..|:..|.:.:|  
  Fly   217 VNQVEIWPGFLQKD--LVDYCRY-----NGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYK 274

  Fly   258 --ASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEV----GLSDKEQEVL 316
              ||::.....::.|.:.       :|:.:..:...:...:....||..:.    |:..|.:.|.
  Fly   275 RSASQIVLRYLIDYGVVP-------IPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVK 332

  Fly   317 RYLKENVLTKPFDW--EGNE 334
            ..:.::.:..||:.  |.||
  Fly   333 YEIVKDHMFYPFELLKENNE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 71/340 (21%)
Aldo_ket_red 24..321 CDD:294321 69/328 (21%)
ARYNP_001163844.1 ARA1 37..332 CDD:223729 66/319 (21%)
Tas 50..324 CDD:223739 61/298 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.