DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and F53F1.3

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_506323.1 Gene:F53F1.3 / 186169 WormBaseID:WBGene00009981 Length:283 Species:Caenorhabditis elegans


Alignment Length:167 Identity:43/167 - (25%)
Similarity:73/167 - (43%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NYGFDL------------EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALK------DVP 93
            |.|:|.            ::.:..:..|:.:|....|||..|   .:|:.:|.||:      ::.
 Worm     6 NTGYDCPLIGLGTYKIIGDQVLPVLDAALTAGYRLFDTAKVY---NNEKEIGDALEILLPKHNLK 67

  Fly    94 RESYYIATKVARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIHDIEFAKDLDI----V 154
            ||..:|.|          ||...:.:..::.|::||.||...|:|:..||   :.|..|.    .
 Worm    68 REDIFITT----------KMHPNTVENVKKLVDESLSLLKTSYIDMYLIH---YPKSFDYGDQDP 119

  Fly   155 INETL-----PTLEQLVKEGKARFIGVSAYPISVLKE 186
            :|:||     ..|.:....||.|.:|||::.|..|:|
 Worm   120 MNKTLRIATWNDLWECKNAGKIRSVGVSSFEIRHLEE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 43/167 (26%)
Aldo_ket_red 24..321 CDD:294321 43/167 (26%)
F53F1.3NP_506323.1 AKR_AKR1-5-like 12..265 CDD:381297 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.