DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and C07D8.6

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_509242.1 Gene:C07D8.6 / 180997 WormBaseID:WBGene00015565 Length:317 Species:Caenorhabditis elegans


Alignment Length:312 Identity:79/312 - (25%)
Similarity:120/312 - (38%) Gaps:83/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKVARYELDYDK 112
            |.|..|..|||:|...||||..|   ::||.:|.|:|:      |.||..:|.||...:||    
 Worm    30 EVITAVKTAVKAGYRLIDTASVY---QNEEAIGTAIKELLEEGVVKREELFITTKAWTHEL---- 87

  Fly   113 MFDFSAKKTRESVEKSLKLLGLDYVDVIQIH-----DIEFAKDLDIVINETLPTLEQLVKEGKAR 172
                :..|....:.:|||.|.|:|||:...|     :.:.::.:...:.:.....:.:.|.|.|:
 Worm    88 ----APGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHIASPVEDVWRQFDAVYKAGLAK 148

  Fly   173 FIGVSAYPISVLKEFLTRTA-----GRLDTVLTYARYTLTDETLLEYLDFFKSQNLGVICAAAHA 232
            .:|||.:....:...|....     .:::..|.:.::        :::||.|..|:.|...|  .
 Worm   149 AVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQH--------DHVDFCKKHNISVTSYA--T 203

  Fly   233 LG-------LLTNAGPQPWHPA-SDEQK----AIARKASEVCKERGVELGKLAMYYTMSGLPEVS 285
            ||       .|.......|.|| ||.|.    |:|.|                            
 Worm   204 LGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEK---------------------------- 240

  Fly   286 TFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDWEGNELEI 337
            |..|..|.  |||..||.....|....||  ..:|||.  :.||:...|.:|
 Worm   241 THKTPAQV--LLRYALDRGCAILPKSIQE--NRIKENF--EVFDFSLTEEDI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 77/304 (25%)
Aldo_ket_red 24..321 CDD:294321 72/294 (24%)
C07D8.6NP_509242.1 AKR_AKR1G1_CeAKR 5..301 CDD:381380 79/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.