Sequence 1: | NP_650138.1 | Gene: | CG18547 / 41452 | FlyBaseID: | FBgn0037973 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379192.1 | Gene: | F53F1.2 / 179821 | WormBaseID: | WBGene00009980 | Length: | 297 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 57/196 - (29%) |
---|---|---|---|
Similarity: | 84/196 - (42%) | Gaps: | 37/196 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 TGLQVSKVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD-VP 93
Fly 94 RESYYIATKVARYELDYDKMFDFSAKKTRES----VEKSLKLLGLDYVDVIQIHDIEFAK----D 150
Fly 151 LDIVINE-----TLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRT-----AGRLDTVLTYARYT 205
Fly 206 L 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18547 | NP_650138.1 | Tas | 22..331 | CDD:223739 | 57/196 (29%) |
Aldo_ket_red | 24..321 | CDD:294321 | 57/196 (29%) | ||
F53F1.2 | NP_001379192.1 | AKR_AKR1-5-like | 21..279 | CDD:381297 | 56/192 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.985475 | Normalized mean entropy | S2698 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |