DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c3

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_612519.1 Gene:Akr1c3 / 171516 RGDID:708428 Length:323 Species:Rattus norvegicus


Alignment Length:339 Identity:79/339 - (23%)
Similarity:136/339 - (40%) Gaps:70/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AKVRRMEYRNLGKTGLQVSKVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRS 81
            :|:::||..:    |..:..:.||..|...|.   .::.:::...|:..|..:||.:..|   ::
  Rat     3 SKIQKMELND----GHSIPVLGFGTYATEENL---RKKSMESTKIAIDVGFRHIDCSHLY---QN 57

  Fly    82 EEVLGLALKD------VPRESYYIATKV----ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDY 136
            ||.:|.|:..      |.||..:..:|:    .|.||            .|.|:|.||:.|.|||
  Rat    58 EEEIGQAIVSKIEDGTVKREDIFYTSKLWSTSHRPEL------------VRPSLENSLRKLNLDY 110

  Fly   137 VDVIQIH--------DIEFAKD------LDIV-INETLPTLEQLVKEGKARFIGVSAYPISVLKE 186
            ||:..||        |....:|      ||.| :.:|...:|:....|.|:.||||.:....|::
  Rat   111 VDLYLIHFPVSLKPGDELLPQDEHGNLILDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEK 175

  Fly   187 FLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPWHPASD 249
            .|.:...:...|...  ....|....||.|.   |..::.::     |.|.|   |.|.:....:
  Rat   176 ILNKPGLKHRPVCNQVECHLYLNQSKLLAYC---KMNDIVLV-----AYGAL---GTQRYKYCIN 229

  Fly   250 EQKAIARKASEVC---KERGVELGKLAMYYTMS-GLPE-VSTFLTGMQTRQLLRINLDANEVGLS 309
            |...:......:|   |:.......:|:.|.:. |:.. |.:|     ..:.:|.||...:..|:
  Rat   230 EDTPVLLDDPILCTMAKKYKRTPALIALRYQLERGIVTLVKSF-----NEERIRENLQVFDFQLA 289

  Fly   310 DKEQEVLRYLKENV 323
            ..:.|:|..|..|:
  Rat   290 SDDMEILDNLDRNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 78/334 (23%)
Aldo_ket_red 24..321 CDD:294321 75/328 (23%)
Akr1c3NP_612519.1 AKR_AKR1C1-35 6..308 CDD:381334 78/336 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.