DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Kcnab1

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001344287.1 Gene:Kcnab1 / 16497 MGIID:109155 Length:419 Species:Mus musculus


Alignment Length:351 Identity:90/351 - (25%)
Similarity:153/351 - (43%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HDEAKVRRMEYRNLGKTGLQVS------KVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDT 72
            |..|....|.:|||||:||:||      .|:|||     ....::.|.:.|:  |.:||:|..||
Mouse    81 HTTAHTTGMPHRNLGKSGLRVSCLGLGTWVTFGG-----QISDEVAERLMTI--AYESGVNLFDT 138

  Fly    73 APWYGQGRSEEVLGLALKDV--PRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLL 132
            |..|..|::|.:||..:|..  .|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.|
Mouse   139 AEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETER----GLSRKHIIEGLKGSLQRL 199

  Fly   133 GLDYVDVIQIHDIEFAK--DLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKE--FLTRTAG 193
            .|:||||:      ||.  |.:..:.|.:..:..::.:|.|.:.|.|.:....:.|  .:.|...
Mouse   200 QLEYVDVV------FANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFN 258

  Fly   194 RLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT----NAGPQ---------P 243
            .:..|...|.|.|  .::..::..:.:....:|.:..:..|.|:::    |..|:         .
Mouse   259 MIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQ 323

  Fly   244 W---HPASDE---QKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLD 302
            |   ...|:|   |:...:..|.:.:..|..|.:||:.:.:.. ..||:.|.|..|.:.|..||.
Mouse   324 WLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRN-EGVSSVLLGSSTPEQLIENLG 387

  Fly   303 ANEVGLSDKEQEVLRYLKENVLTKPF 328
            |.:| |......|:..:...:..||:
Mouse   388 AIQV-LPKMTSHVVNEIDNILRNKPY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 88/343 (26%)
Aldo_ket_red 24..321 CDD:294321 85/332 (26%)
Kcnab1NP_001344287.1 Kv_beta 91..407 CDD:213602 85/334 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.