DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AKR1C2

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001345.1 Gene:AKR1C2 / 1646 HGNCID:385 Length:323 Species:Homo sapiens


Alignment Length:311 Identity:79/311 - (25%)
Similarity:128/311 - (41%) Gaps:81/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALK------DVPRESYYIATKV----ARYEL 108
            :.::.|..|:::|.::||:|..|   .:||.:|||::      .|.||..:..:|:    .|.||
Human    33 KALEAVKLAIEAGFHHIDSAHVY---NNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPEL 94

  Fly   109 DYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIHDIEFAKDLDIVINE---------------T 158
                        .|.::|:|||.|.|||||:..||.....|..:.||.:               |
Human    95 ------------VRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCAT 147

  Fly   159 LPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQN 222
            ...:|:....|.|:.||||.:...:|:..|.:...:...|..... :...::..|  |||.||::
Human   148 WEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKL--LDFCKSKD 210

  Fly   223 LGVICAAAHALGLLTNAGPQPW----HPASDEQK---AIARK--------ASEVCKERGVELGKL 272
              ::..|..|||   :...:||    .|...|..   |:|:|        |.....:|||.:  |
Human   211 --IVLVAYSALG---SHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVV--L 268

  Fly   273 AMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENV 323
            |..|                ..|.:|.|:...|..|:.:|.:.:..|..||
Human   269 AKSY----------------NEQRIRQNVQVFEFQLTSEEMKAIDGLNRNV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 79/311 (25%)
Aldo_ket_red 24..321 CDD:294321 77/307 (25%)
AKR1C2NP_001345.1 AKR_AKR1C1-35 6..308 CDD:381334 79/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.