DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1b7

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_033861.2 Gene:Akr1b7 / 11997 MGIID:101918 Length:316 Species:Mus musculus


Alignment Length:308 Identity:60/308 - (19%)
Similarity:123/308 - (39%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LEEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV-ARYELD 109
            ::|.:|.   |:.:|..:||.|..|   .:|..:|.|:::      |.||..:|.:|: |.:   
Mouse    28 VKEAVKA---AIDAGYRHIDCAYVY---HNENEVGEAIQEKIKENAVKREDLFIVSKLWATF--- 83

  Fly   110 YDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKDL--DIVINETL----- 159
                  |.....:::.:.:|..|.|||:|:..:|        :....||.  .::::::.     
Mouse    84 ------FEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQAGNALLPKDNKGKVLLSKSTFLDAW 142

  Fly   160 PTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQN 222
            ..:|:||.:|..:.:|:|.:....::..|.:...:...|...  :...||.|.|::|     .|:
Mouse   143 EAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQEKLIQY-----CQS 202

  Fly   223 LGVICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTF 287
            .|:...|...||.......:|..|...|...|...|:   |.:......|..::....:..:...
Mouse   203 KGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAA---KHKKTVAQVLIRFHVQRNVVVIPKS 264

  Fly   288 LTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDWEGNEL 335
            :|..:.::    ||...:..||:::...:.....|       |...:|
Mouse   265 VTPSRIQE----NLQVFDFQLSEEDMAAILSFNRN-------WRACDL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 58/302 (19%)
Aldo_ket_red 24..321 CDD:294321 57/292 (20%)
Akr1b7NP_033861.2 AKR_AKR1B1-19 10..316 CDD:381333 60/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.