DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1b7

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:310 Identity:72/310 - (23%)
Similarity:123/310 - (39%) Gaps:78/310 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LEEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLAL------KDVPRESYYIATKVARYELDY 110
            ::|.:|.   |:.:|..:.|.|..|   ::|..:|.|:      |.|.||..:|.:|:      :
  Rat    41 VKEAVKA---AIDAGYRHFDCAYVY---QNESEVGEAIQEKIKEKAVRREDLFIVSKL------W 93

  Fly   111 DKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH---DIEFAKDLDIVINETLPT----------- 161
            ...|:.|..|  |:.:|:|..|.|||:|:..||   .::..|       |.||.           
  Rat    94 STFFEKSLMK--EAFQKTLSDLKLDYLDLYLIHWPQGLQAGK-------EFLPKDSQGKVLMSKS 149

  Fly   162 --------LEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR---YTLTDETLLEYL 215
                    :|:||.:|..:.:|||.:....::..|.:...:...|.....   | ||.|.|::| 
  Rat   150 TFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPY-LTQEKLIQY- 212

  Fly   216 DFFKSQNLGVICAAAHALGLLTNAGPQPWHP-----------ASDEQKAIARKASEVCKERGVEL 269
                ..:.|:...|...||.......:|..|           |:..:|.||:.......:|.|.:
  Rat   213 ----CHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAV 273

  Fly   270 GKLAMYYTMSGLPE-VSTF---LTGMQTRQLLRINLDANEVGL---SDKE 312
              :....|:|.:.| :..|   |:......:|.:|.:....||   ||:|
  Rat   274 --IPKSVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 72/310 (23%)
Aldo_ket_red 24..321 CDD:294321 72/310 (23%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 72/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.