DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr7a5

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_079613.3 Gene:Akr7a5 / 110198 MGIID:107796 Length:367 Species:Mus musculus


Alignment Length:305 Identity:80/305 - (26%)
Similarity:114/305 - (37%) Gaps:71/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DLEEGIKTVHEAVKSGINYIDTAPWYGQGRSEEV-----LGLALKDVPRESYYIATKVARYE--- 107
            |......:|...::.|.:.:|||..|..|:||.:     |||...|.   :..||||...:|   
Mouse    60 DASASAASVRAFLERGHSELDTAFMYCDGQSENILGGLGLGLGSGDC---TVKIATKANPWEGKS 121

  Fly   108 LDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIHDIEFAKDLDIVINETLPTLEQLVKEGKAR 172
            |..|.:        |..:|.|||.|....||:..:|    |.|....:.|||....||.:|||..
Mouse   122 LKPDSI--------RSQLETSLKRLQCPRVDLFYLH----APDHSTPVEETLRACHQLHQEGKFV 174

  Fly   173 FIGVSAYPISVLKEFLT--RTAGRLDTVLTYARYTLT----DETLLEYLDFFKSQNLGVICAAAH 231
            .:|:|.|....:.|..|  ::.|.:...:....|..|    :..||..|..|     |:...|.:
Mouse   175 ELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHF-----GLRFYAYN 234

  Fly   232 AL--GLLTNA-------GPQP-----------------WHPASDEQKAIARKASEVCKERGVELG 270
            .|  ||||..       |.||                 |.....|..|:..||.:.  ..|....
Mouse   235 PLAGGLLTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFEAIALVEKALQT--TYGTNAP 297

  Fly   271 KLA------MYY--TMSGLPEVSTFLTGMQTRQLLRINLDANEVG 307
            ::.      ||:  .:.|....:..| ||.:.:.|..||.|.|.|
Mouse   298 RMTSAALRWMYHHSQLQGTRGDAVIL-GMSSLEQLEQNLAATEEG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 80/305 (26%)
Aldo_ket_red 24..321 CDD:294321 80/305 (26%)
Akr7a5NP_079613.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Tas 46..363 CDD:223739 80/305 (26%)
Aldo_ket_red 46..354 CDD:119408 80/305 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.