Sequence 1: | NP_650138.1 | Gene: | CG18547 / 41452 | FlyBaseID: | FBgn0037973 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598833.1 | Gene: | Akr1c14 / 105387 | MGIID: | 2145458 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 50/199 - (25%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 47/199 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYE 107
Fly 108 LDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKD---------LDIVI 155
Fly 156 NETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFK 219
Fly 220 SQNL 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18547 | NP_650138.1 | Tas | 22..331 | CDD:223739 | 50/199 (25%) |
Aldo_ket_red | 24..321 | CDD:294321 | 50/199 (25%) | ||
Akr1c14 | NP_598833.1 | AKR_AKR1C1-35 | 6..308 | CDD:381334 | 50/199 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848822 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |