DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c14

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 / 105387 MGIID:2145458 Length:323 Species:Mus musculus


Alignment Length:199 Identity:50/199 - (25%)
Similarity:85/199 - (42%) Gaps:47/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYE 107
            :|.||....|:.:|..:.|:|..|   :.||.:|.|::.      |.||..:..:|:    .|.|
Mouse    32 DELIKATKIAIDTGFRHFDSAYLY---QIEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPE 93

  Fly   108 LDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKD---------LDIVI 155
            |            .|..:||:||...|||||:..||        |..|.:|         :|:. 
Mouse    94 L------------VRSCLEKTLKNAQLDYVDLYIIHFPMALQPGDKLFPRDEHGKLLAEAVDLC- 145

  Fly   156 NETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFK 219
             :|...:|:....|.|:.||||.:....|:..|.:...:...|..... :...:::  :.||:.|
Mouse   146 -DTWEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVECHLYLNQS--QMLDYCK 207

  Fly   220 SQNL 223
            |:::
Mouse   208 SKDI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 50/199 (25%)
Aldo_ket_red 24..321 CDD:294321 50/199 (25%)
Akr1c14NP_598833.1 AKR_AKR1C1-35 6..308 CDD:381334 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.