DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c18

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_598827.1 Gene:Akr1c18 / 105349 MGIID:2145420 Length:323 Species:Mus musculus


Alignment Length:353 Identity:78/353 - (22%)
Similarity:129/353 - (36%) Gaps:92/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AKVRRMEYRNLGKTGLQVSKVSFGGGALCANYGFDLEEGIK-----TVHEAVKSGINYIDTAPWY 76
            :|::::|..:    |..:..:.||        .:..||.:|     :...|:..|..:||.:..|
Mouse     3 SKIQKIELND----GHSIPVLGFG--------TYATEEHLKKKSMESTKIAIDVGFCHIDCSHLY 55

  Fly    77 GQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDYDKMFDFSAKKTRESVEKSLKL 131
               ::||.:|.|:..      |.||..:..:|:    .|.||            .|.|:|.||:.
Mouse    56 ---QNEEEIGQAILSKIEDGTVKREDIFYTSKLWSTSHRPEL------------VRPSLENSLRK 105

  Fly   132 LGLDYVDVIQIH--------DIEFAKD------LDIV-INETLPTLEQLVKEGKARFIGVSAYPI 181
            |.|||||:..||        :....||      .|.| :.:|...:|:....|.|:.||||.:..
Mouse   106 LNLDYVDLYLIHFPVSLKPGNELLPKDEHGNLIFDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNR 170

  Fly   182 SVLKEFLTRTAGRLDTVLTY--ARYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPW 244
            ..|:..|.:...:...|...  ....|....||.|.   |..::.::     |.|.|   |.|.:
Mouse   171 RQLEMILNKPGLKYKPVCNQVECHLYLNQSKLLAYC---KMNDIVLV-----AYGAL---GTQRY 224

  Fly   245 HPASDEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLS 309
            ....:|...:......:|          ||.......|.:..          ||..||...|.|:
Mouse   225 KYCINEDTPVLLDDPVLC----------AMAKKYKRTPALIA----------LRYQLDRGIVALA 269

  Fly   310 DKEQEVLRYLKENVLTKPFDWEGNELEI 337
            ....|  ..::||:....|....::::|
Mouse   270 KSFNE--ERIRENMQVFDFQLASDDMKI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 76/340 (22%)
Aldo_ket_red 24..321 CDD:294321 72/328 (22%)
Akr1c18NP_598827.1 ARA1 7..310 CDD:223729 77/349 (22%)
Tas 15..297 CDD:223739 75/337 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.