DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and kcnab2

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_017950940.2 Gene:kcnab2 / 100486636 XenbaseID:XB-GENE-990281 Length:455 Species:Xenopus tropicalis


Alignment Length:378 Identity:89/378 - (23%)
Similarity:161/378 - (42%) Gaps:68/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATYVKGFHD----------EAKVRR--MEYRNLGKTGLQVSKVSFG-----GGALCANYGFDLEE 54
            |.:||...:          |...|:  |:||||||:||:||.:..|     ||.:..    ::.|
 Frog    83 AAHVKNMEEFLKMHGLSLNECTARKTGMKYRNLGKSGLRVSCLGLGTWVTFGGQITD----EMAE 143

  Fly    55 GIKTVHEAVKSGINYIDTAPWYGQGRSEEVLG--LALKDVPRESYYIATKV---ARYELDYDKMF 114
            .:.|:  |..:|||..|||..|..|::|.|||  :..|...|.|..|.||:   .:.|.:.    
 Frog   144 QLMTL--AYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETER---- 202

  Fly   115 DFSAKKTRESVEKSLKLLGLDYVDVI-----------QIHDIEFAKDLDIVINETLPTLEQLVKE 168
            ..|.|...|.::.||:.|.||||||:           :......:|....:|.||:..:..::.:
 Frog   203 GLSRKHIIEGLKASLERLQLDYVDVVFANRPDPNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQ 267

  Fly   169 GKARFIGVSAY-PISVLKEF-LTRTAGRLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAA 229
            |.|.:.|.|.: .:.:::.: :.|....:..:...|.|.:  .::..::..:.|....:|.:..:
 Frog   268 GMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWS 332

  Fly   230 AHALGLLT---NAGPQPWHPAS----------------DEQKAIARKASEVCKERGVELGKLAMY 275
            ..|.|:::   :.|..|:..||                ..|:|..::...:.:..|..|.:||:.
 Frog   333 PLACGIVSGKYDGGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIA 397

  Fly   276 YTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPF 328
            :.:.. ..||:.|.|......|..|:.|.:| |......::..:...:..||:
 Frog   398 WCLRN-EGVSSVLLGASNADQLLENIGAIQV-LPKLSSSIIHEIDSILGNKPY 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 84/351 (24%)
Aldo_ket_red 24..321 CDD:294321 81/340 (24%)
kcnab2XP_017950940.2 Aldo_ket_red_shaker 111..435 CDD:381367 81/335 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.080

Return to query results.
Submit another query.