DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and CG15020

DIOPT Version :9

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster


Alignment Length:180 Identity:43/180 - (23%)
Similarity:70/180 - (38%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVHVSANKQQKNQNQEIWEQDLSDTFKIEGSDQGIQKVNLKCGADSMNVVLETEKPFMGVMYTRG 83
            ||....:|.|    :|.|:|:.:. .:.:.:...:|.:..:|..|.|.:.:.....|.|::|:.|
  Fly   188 AVPYENSKWQ----EEYWDQEYAG-HQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAG 247

  Fly    84 SFYKQSAPCFMKPSSSQGSRTMEMNFQLDQCQTIRDGDLYT-----------NIVVIQNDPELIT 137
              |.....|..  .:..|....|...||::|.|:....|..           |.|.:|.:|.:..
  Fly   248 --YAYDPDCMY--INGSGRDYYEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEE 308

  Fly   138 PGDSAFSLEC----DFRQPRN---LDVEASMQARDRVATGSKITLTSPDP 180
            ..|..|.:.|    ||.:...   ||||        ||||:.:..|...|
  Fly   309 EYDEHFKVTCEYGYDFWKTVTFPFLDVE--------VATGNPVVFTLSPP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/120 (24%)
CG15020NP_647901.1 ZP 223..473 CDD:214579 35/140 (25%)
Zona_pellucida <371..472 CDD:278526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.