DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and dyl

DIOPT Version :9

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:58/135 - (42%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NQEIWEQDLSDTFKIEGSDQGIQKVNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKP 96
            ::|.|  .|:.|   ..|.| |:.:.::|....|.|.:|.::||.|:::::| ||.......:||
  Fly    69 SEEAW--PLAST---NDSPQ-IKHLQVQCEKTHMRVNIEFDRPFYGMIFSKG-FYSDPHCVHLKP 126

  Fly    97 SSSQGSRTMEMNFQLDQC--------------QTIRDGDLYTNIVVIQNDPELITPGDSAFSLEC 147
            .:...|.|.|:  .|:.|              .....|....|.::||.||.:....|.|..|.|
  Fly   127 GTGHLSATFEI--FLNSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRC 189

  Fly   148 ---DF 149
               ||
  Fly   190 TWYDF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/108 (27%)
dylNP_647890.2 ZP 90..345 CDD:214579 29/108 (27%)
PHA03378 <339..494 CDD:223065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.