DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and cyr

DIOPT Version :9

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster


Alignment Length:181 Identity:46/181 - (25%)
Similarity:69/181 - (38%) Gaps:34/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IQKVNLKCGADSMNVVLETEKPFMGVMY---------TRGSFYKQSAPCFMK-PSSSQGSRTMEM 107
            ||.:.:.|..:.:.:.||..:||.|::|         .||   |.|....:: |:|..|.|    
  Fly    68 IQAMQVNCSRELLEMHLELSRPFRGLLYAKDFPLECRARG---KDSTRLHLRIPTSGCGVR---- 125

  Fly   108 NFQLDQCQTIRDGDL-YTNIVVIQNDPELITPGDSAFSLECDFRQPRN-----LDVEASMQARDR 166
                  .:.:.||.| ||..|::|.:.:|....|...|:.|..  |.|     |.|....:..||
  Fly   126 ------AEPLEDGSLEYTVRVMLQKEQKLRQSTDILSSVRCQL--PANAMGMPLPVLRQEKGHDR 182

  Fly   167 VATGSKITLTSPDPAAPTEHLHNSVVSNSDSVAYIPKFSRPNRTIHLGSVE 217
            .|....:...:..||.......|.....:..|....:...||.|   ||||
  Fly   183 NARMRALAAAAAVPALGATSSINQQQRETPRVRIWLELGGPNGT---GSVE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 30/118 (25%)
cyrNP_001285004.1 ZP 82..344 CDD:214579 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.