Sequence 1: | NP_650137.3 | Gene: | CG10005 / 41451 | FlyBaseID: | FBgn0037972 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510492.2 | Gene: | cutl-3 / 184721 | WormBaseID: | WBGene00008978 | Length: | 405 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 42/201 - (20%) |
---|---|---|---|
Similarity: | 83/201 - (41%) | Gaps: | 25/201 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 FKIEGSDQGIQ-KVNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEM 107
Fly 108 NFQL--DQCQTIRD------GDLYTNIVVIQNDPELITPGDSAFSLECDF-------RQPRNLDV 157
Fly 158 EASMQARDRVATGSKITLTSPDPAAPTEHLHN-SVVSNSDSVAY-IPKFSRPNRTIHLGSVEEVT 220
Fly 221 LPSSSQ 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10005 | NP_650137.3 | ZP | 59..>162 | CDD:214579 | 25/117 (21%) |
cutl-3 | NP_510492.2 | ZP | 33..306 | CDD:214579 | 38/185 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |