DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and cutl-3

DIOPT Version :9

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_510492.2 Gene:cutl-3 / 184721 WormBaseID:WBGene00008978 Length:405 Species:Caenorhabditis elegans


Alignment Length:201 Identity:42/201 - (20%)
Similarity:83/201 - (41%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FKIEGSDQGIQ-KVNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEM 107
            :..|..|.|:| :..::||::|:::..:|:..|.|.:|.:|.:       .||...:..:...::
 Worm    17 YHAEQIDNGLQGEPLIRCGSESLSINFKTQGAFEGHVYVKGHY-------SMKHCRTDATLESQV 74

  Fly   108 NFQL--DQCQTIRD------GDLYTNIVVIQNDPELITPGDSAFSLECDF-------RQPRNLDV 157
            |..:  ..|..||.      |.:.|..::|...|..||..|.::.::|.:       .|..|:|:
 Worm    75 NLTVSYSACDVIRQRSSNPKGIMMTATIIISFHPMFITKIDKSYKVQCFYAEAQKTVTQQLNVDI 139

  Fly   158 EASMQARDRVATGSKITLTSPDPAAPTEHLHN-SVVSNSDSVAY-IPKFSRPNRTIHLGSVEEVT 220
            ....:.:..|..|.:...|........:.||. :..|..:.::| :|......|.:.....|||.
 Worm   140 AKEQEKKIFVMVGDEEGGTVSHTTGDQKKLHKLNDPSTEERISYNVPLPDCKYRVLTESKTEEVA 204

  Fly   221 LPSSSQ 226
            ..:..|
 Worm   205 FATVGQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 25/117 (21%)
cutl-3NP_510492.2 ZP 33..306 CDD:214579 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.