DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and cutl-2

DIOPT Version :9

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_496097.1 Gene:cutl-2 / 174532 WormBaseID:WBGene00013145 Length:382 Species:Caenorhabditis elegans


Alignment Length:178 Identity:46/178 - (25%)
Similarity:78/178 - (43%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IQKVN--------LKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEMNF 109
            ||.||        ::|....:.::|||:.||.|.::.|||..|:|.....   |:|.|:.:...|
 Worm    14 IQHVNSDIIGEPKIRCAPTGITIMLETDSPFKGALFLRGSADKKSCKANF---SAQPSQNISFEF 75

  Fly   110 QLDQCQTIRD-------GDLYTNIVVIQNDPELITPGDSAFSLECDFR---------------QP 152
            ..|.|.:.|.       |...::::|:.....:||..|.|:.::|.:|               ||
 Worm    76 GFDDCPSRRKRQIVAPRGMTMSSVLVVSYHGSIITHRDVAYQIDCFYREENSRVETMLSVNAPQP 140

  Fly   153 RNLDVEASMQARD-RV-ATGSK------ITLTSPDPAAPTEHLHNSVV 192
            |.|..|..:...| || .||.|      :|.:..:.|:...::.:||:
 Worm   141 RILSDEPKLPTCDYRVEVTGGKAVAGGIVTSSLSETASQIANVGDSVI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 32/124 (26%)
cutl-2NP_496097.1 ZP 28..286 CDD:214579 42/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.