DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and YML018C

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_013694.1 Gene:YML018C / 854990 SGDID:S000004480 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:63/307 - (20%)
Similarity:103/307 - (33%) Gaps:87/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LISNRRGVISDLDSILSQDSSEFRPVSMLLPTL----------------------LDAAASILLF 108
            ||....|..||.:          |.|.|..|.|                      |.|...||.|
Yeast    84 LIMEEEGTGSDSN----------RSVDMTSPLLTNLEAGTHANQKKRLTLYETIKLSAEFCILWF 138

  Fly   109 TGLYLTYATSFQMIRGAALIFVGI-----------FSTMFLN-----HTLTGRHWLAIFTISCGL 157
            |.         .::..|:|.|..:           |.|:|:.     .:|:....|..|....|:
Yeast   139 TA---------NLVTNASLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVLGSFISFVGI 194

  Fly   158 LDIISLDVH-RVEYDL--VTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQA- 218
            :.:...|.| |.:..:  |:....|...:|.|:||.:...:|:|:.....::::.......::. 
Yeast   195 IMVTKSDSHQRYQRHIADVSGDDNDAVQVLIGNLLALAGAVLYGVYSTLLKREVGDETRVNMKIF 259

  Fly   219 AGWQGIFGLGITSMLAICMNFLPSIDPFS--------------CSSRAVFD-DWGDLFAALQGSI 268
            .|:.|:|.|.......|.::|. ..:|||              |....|.| .|..  |.|..|.
Yeast   260 FGFVGLFNLLFLWPSLIVLDFF-GWEPFSLPKDPKVVVIIFVNCLITFVSDFCWAK--AMLLTSP 321

  Fly   269 SLIMTLIAFTISCAMYNFI----GLYIAMYSSSANRLLADGLRVYFI 311
            ..:...::.||..||:..:    ....|:|...|..:|..    :||
Yeast   322 LTVTVGLSITIPLAMFGDVIFKHKTMSALYLFGATLILGS----FFI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
YML018CNP_013694.1 RhaT <142..367 CDD:223769 47/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.