DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and YMD8

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_013674.1 Gene:YMD8 / 854970 SGDID:S000004502 Length:442 Species:Saccharomyces cerevisiae


Alignment Length:401 Identity:81/401 - (20%)
Similarity:159/401 - (39%) Gaps:93/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHRVFLSLIFVLSGTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIR 65
            |:..|||:  ||....|..:.:...|:......||.  |..:||:.|.......:|...::..:|
Yeast     1 MNRTVFLA--FVFGWYFCSIALSIYNRWMFDPKDGL--GIGYPVLVTTFHQATLWLLSGIYIKLR 61

  Fly    66 LISNRRGVISDLDSILSQDS----SEFRPVSMLLPTLLDAAASILLFTGLYLTYA--TSFQMIRG 124
                    ...:.::|.:::    |.|  :..||||.:.:|..|.| :.:...|.  |.:.:|:.
Yeast    62 --------HKPVKNVLRKNNGFNWSFF--LKFLLPTAVASAGDIGL-SNVSFQYVPLTIYTIIKS 115

  Fly   125 AALIFVGIFSTMFLNHTLTGRHW---LAIFTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTG 186
            :::.||.:|..:|   .|...||   |::..:..|    ::|.|.:....  |....|...::.|
Yeast   116 SSIAFVLLFGCIF---KLEKFHWKLALSVIIMFVG----VALMVFKPSDS--TSTKNDQALVIFG 171

  Fly   187 DLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSID---PFSC 248
            ..|::.:..|.||::|..:..|:.:.:....||..:...|       |:......::|   ..:.
Yeast   172 SFLVLASSCLSGLRWVYTQLMLRNNPIQTNTAAAVEESDG-------ALFTENEDNVDNEPVVNL 229

  Fly   249 SSRAVFDDWGD----------LFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANR--- 300
            ::..:.:::|:          ..|.:.| |:|::|.:     .....|.|:    :|||..|   
Yeast   230 ANNKMLENFGESKPHPIHTIHQLAPIMG-ITLLLTSL-----LVEKPFPGI----FSSSIFRLDT 284

  Fly   301 --------------------LLADGLRVYFIWVFVI-IMEWEYMNLVTIMG----FLILQMGIIL 340
                                |:..|..|:.:.:... |:|...:..|:|:|    .|.:..|||:
Yeast   285 SNGGVGTETTVLSIVRGIVLLILPGFAVFLLTICEFSILEQTPVLTVSIVGIVKELLTVIFGIII 349

  Fly   341 YRQAL--FLDW 349
            ..:.|  |.:|
Yeast   350 LSERLSGFYNW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
YMD8NP_013674.1 TPT_S35C2 77..371 CDD:411044 64/313 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.