DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35a4

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001242972.1 Gene:slc35a4 / 777628 ZFINID:ZDB-GENE-061103-595 Length:314 Species:Danio rerio


Alignment Length:344 Identity:77/344 - (22%)
Similarity:124/344 - (36%) Gaps:91/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLSLIFVLSGTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLC-------FAVFK 62
            :||.|:.||                       ::|...|::         .||       |:...
Zfish    22 LFLLLLLVL-----------------------IYGSHAPLL---------SLCKTQAQIPFSASS 54

  Fly    63 VIRLISNRRGVISDLDSILSQDSSEFR-PVSM------LLPTLLDAAAS-ILLFTGLYLTYATSF 119
            .:.||...:..||....:.|...|..| .:||      .:|.:|.|..: :::|...|:. .:||
Zfish    55 CVLLIETSKLFISFASLLASGSVSTLRISISMTTASPYAVPAVLYAFNNHLVVFMQAYMD-PSSF 118

  Fly   120 QMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPYTDYKSIL 184
            |::....:....:..|..|...|..|.|.|:     |||....:......|||.....|......
Zfish   119 QVLSNLKIASTALLYTSCLGKRLHRRQWFAM-----GLLVSAGVSHSCFSYDLEGKQETAVYITS 178

  Fly   185 TGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIF--GLGITSMLAICMNFLPSIDPFS 247
            .|.||:::...:.||..|..|:.||:..: ||   ..|.:|  ..|:...||..::.......|.
Zfish   179 WGLLLVLVYCFVSGLAAVYTERVLKSQRL-PL---SMQNLFLYAFGVVVNLASHLSGGEQKGFFE 239

  Fly   248 CSSRAVFDDWGDLFAALQGSISLIMTLI---------AFTISCAMYNFIGLYIAMYSSSANRLLA 303
            ..|..|   |  :..|.|.:..|:|:::         .|.||.||.             .|.:|:
Zfish   240 GYSAVV---W--VIVAGQVANGLLMSVVMKHGTGITRLFVISSAML-------------VNAVLS 286

  Fly   304 DG-----LRVYFIWVFVII 317
            .|     |..||::..|:|
Zfish   287 WGILGVQLTGYFLFPVVLI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35a4NP_001242972.1 EamA 93..312 CDD:304911 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.