DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35b3

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_009295562.1 Gene:slc35b3 / 664769 ZFINID:ZDB-GENE-060312-46 Length:386 Species:Danio rerio


Alignment Length:369 Identity:67/369 - (18%)
Similarity:120/369 - (32%) Gaps:140/369 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISNRRGVISDLDSILSQDSS 86
            :|...:.:|:|.:  |:.|..|..| .:...|.||.:.::          |.:.:|  |.|.:. 
Zfish    44 IKSVEELRVLGIN--LNSFNTPTQF-FICVAGVFLFYLIY----------GYLQEL--IFSVEG- 92

  Fly    87 EFRPVSMLLPTLLDAAASILLFTGLYLTY-------ATSFQMIRGAALIFVGIFSTMFLNHTLTG 144
             |:|....|..:.....|:.....|.||.       ..::.:|   |.:.||   ||.|::|..|
Zfish    93 -FKPFGWYLTLVQFGFYSLFGLVELQLTQDKRRRIPCKTYMII---AFLTVG---TMGLSNTSLG 150

  Fly   145 --RHWLAIFTISCGLLDII--SLDVHRVEYD-------------LVTLPYTDYKSI----LTGDL 188
              .:...:....|.|:.::  .:.:....|:             |:.....|.|..    :||.|
Zfish   151 YLNYPTQVIFKCCKLIPVMIGGVFIQGKRYNVADVSAALCMSLGLIWFTLADSKIAPNFNVTGVL 215

  Fly   189 LIIIAEILHGLQYVCEEKQLKTSNVA------------------------------------PLQ 217
            ||.:|..........:||.:|..|.:                                    |:.
Zfish   216 LISLALCADAAIGNVQEKAMKLHNGSNSEMVLYSYSIGFVYILLGLLSLGGLGPAVSFCAQHPMT 280

  Fly   218 AAGWQGIFGL----GITSMLA---------------------ICMNFLPSIDPFSCSSRAVFDDW 257
            ..|:..:|.|    ||:.:||                     |.::||....||:...     .|
Zfish   281 TYGYAFLFSLTGYFGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFLFFSKPFTFQY-----VW 340

  Fly   258 GDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANRL 301
            |.|             |:.|          |:::.:||.:.:::
Zfish   341 GGL-------------LVVF----------GIFLNVYSKNKDKM 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35b3XP_009295562.1 UAA 65..356 CDD:285625 60/339 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.