DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35f2l

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_017206555.2 Gene:slc35f2l / 559645 ZFINID:ZDB-GENE-130530-1004 Length:389 Species:Danio rerio


Alignment Length:229 Identity:59/229 - (25%)
Similarity:91/229 - (39%) Gaps:52/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLL 158
            ||..:.|..|:..:......|..||.|::....:..:.|.|..||.......|:.|:.....|:.
Zfish   109 LLLAVADVEANYAVVKAYQYTTLTSIQLLDCFIIPVLMILSWFFLKTRYRIIHYAAVGICLAGVG 173

  Fly   159 DIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQG 223
            .::..|:      |..........:|.||.|::::..|:.:..||:|..:|  |::.::..|..|
Zfish   174 AMVGADI------LAGQDQGSSSDVLLGDGLVLVSATLYAISNVCQEYTVK--NLSRVEFLGMVG 230

  Fly   224 IFG-------LGI------------------TSMLAICM----NFLPSIDPFSCSSRAVFDD--W 257
            :||       |||                  .|..|:||    :|:|.:...| |:.||...  .
Zfish   231 LFGSIISAIQLGILEHKEVANIQWTWEKALLLSGYALCMYGFYSFMPVVIKRS-SATAVNLSLLT 294

  Fly   258 GDLFAALQGSISLIMTLIAFTISCAMYNFIGLYI 291
            ||||       ||...|..|     .|||.||||
Zfish   295 GDLF-------SLFFGLFLF-----HYNFSGLYI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35f2lXP_017206555.2 SLC35F 32..329 CDD:283644 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.