DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35a3b

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001017900.1 Gene:slc35a3b / 550599 ZFINID:ZDB-GENE-050417-460 Length:364 Species:Danio rerio


Alignment Length:361 Identity:72/361 - (19%)
Similarity:131/361 - (36%) Gaps:82/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFVLSGTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLI----SNR 70
            :.|...|..||.::::.         .|| .:.|    |.:.....:|..:.|::..|    .:.
Zfish    49 VLVFQTTTLVLTMRYSR---------TLH-TEEP----LYLASSAVVCAELLKIVACILLVFRDH 99

  Fly    71 RGVISDLDSILSQDSSEFRP---VSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGI 132
            ...:..|:.:|.::... ||   :.:.:|:.:....:.||:..|....|.::|:.....::...:
Zfish   100 SFSVRSLNLVLKEEIIN-RPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTAL 163

  Fly   133 FSTMFLNHTLTGRHWLAIFTISCGLLDI---ISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAE 194
            ||...|...|....||::..:..|:..:   ..:.....|.||..      .|.|.|.|.:::|.
Zfish   164 FSVSMLGKRLGIYQWLSLVILMIGIALVQWPTEVSSSTGEKDLTA------SSQLIGLLAVLVAC 222

  Fly   195 ILHGLQYVCEEKQLKTSN----VAPLQAAGWQGIFGLGITSMLAICMNFLPSIDPFSCSSRAVFD 255
            ...|...|..||.||.|.    |..:|...:..:||.|               ..|:.....|.:
Zfish   223 FSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFG---------------GVFTYDRERVLE 272

  Fly   256 DWGDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIMEW 320
            :  .||   ||..::..:::      |:....||.||.....|:.:|..     |.....||   
Zfish   273 N--GLF---QGYNNVTWSVV------ALQALGGLVIAAVIKYADNILKG-----FATSISII--- 318

  Fly   321 EYMNLVTIMGFLILQ---------MGIILYRQALFL 347
                |.|::.:.:|.         :|.:|...|.||
Zfish   319 ----LSTLISYFLLDDFDPTSVFFLGAMLVIAATFL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35a3bNP_001017900.1 Nuc_sug_transp 38..352 CDD:282054 72/361 (20%)
nst 123..351 CDD:129885 57/272 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.