DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35a5

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006248404.1 Gene:Slc35a5 / 498081 RGDID:1564361 Length:454 Species:Rattus norvegicus


Alignment Length:391 Identity:75/391 - (19%)
Similarity:137/391 - (35%) Gaps:135/391 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLIFVLSGTFNVLVVKW-ANQQQVIGSDGKLHGFQHPVVFTLLMFLGE----FLCFAV------ 60
            |.:||:...:..:|:||: ||::.           ::..:.|.:....|    .||..|      
  Rat    51 LGVIFITLSSSRILLVKYSANEEN-----------KYDYLPTTVNVCSELMKLILCILVSLCIVK 104

  Fly    61 -----FKVIRLISNRR----------GVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTG 110
                 .|.:|..|.:.          ..:..||:::     .|..:|.|.|     |.:::....
  Rat   105 KEDHQSKHVRCTSWKEFSGFLKWSIPAFLYFLDNLI-----VFYVLSYLQP-----AMAVIFSNF 159

  Fly   111 LYLTYATSFQM--------IRGAAL--IFVGIF----STMFLNHTLTGR--HWLAIFTIS----- 154
            ..:|.|..|::        |:.|:|  :|:.|.    ||....|.|.|.  |..|.||.|     
  Rat   160 SIITTALLFRIVLKRHLNWIQWASLLILFLSIVALTASTKTSQHDLAGHGFHHDAFFTPSNSCLH 224

  Fly   155 ----CGLLDIISLDVHRVEYDLVTLPYTDYKSILT------GDLLIIIAEILHGLQYVCEEKQLK 209
                |.|.|    :....|:....:.:.....:.:      |.:|||:...:..:..:..||.||
  Rat   225 FRRDCSLGD----NCTSKEWAFSDVQWNSTARVFSHIRLGLGHVLIIVQCFISSMANIYNEKILK 285

  Fly   210 -------------------------------TSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSI 243
                                           :||...:|..|:  .:|....|::.|   |:.:.
  Rat   286 EGTQHTESIFIQNSKLYFFGIVFNGLTLVLQSSNRDQIQNCGF--FYGHNAFSVVLI---FVTAF 345

  Fly   244 DPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNF------------IGLYIAMYSS 296
            ...|.:....|.|  ::|..|...::   |:|..|:|..:::|            :.|.|.:|::
  Rat   346 QGLSVAFILKFLD--NMFHVLMAQVT---TVIITTVSVLVFDFRPSLDFFLEAPSVLLSIFIYNA 405

  Fly   297 S 297
            |
  Rat   406 S 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35a5XP_006248404.1 Nuc_sug_transp 53..404 CDD:282054 72/385 (19%)
EamA <131..192 CDD:304911 14/70 (20%)
EamA <244..403 CDD:304911 28/168 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.