DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and sll

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster


Alignment Length:288 Identity:61/288 - (21%)
Similarity:104/288 - (36%) Gaps:85/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LYLTYATSFQMIRGA-----ALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLD--VHRV 168
            ||.....||..|..|     ||.||. |.|.             :...||.::.::.:.  :.:.
  Fly   216 LYKYSYASFSNIMSAWFQYEALKFVN-FPTQ-------------VLAKSCKIIPVMLMGKIMSKA 266

  Fly   169 EYDLVTLPYTDYKSILTGDLLIIIAEI--LHGLQYVCEEKQLKTSNVAPLQ-------------- 217
            :|:       .|:.:..  |||.:..|  :.|     .....|.|.|..|.              
  Fly   267 KYE-------SYEYVTA--LLISLGMIFFMSG-----SSDSSKASGVTTLTGIFLLSMYMVFDSF 317

  Fly   218 AAGWQG-IF-GLGITSMLAIC-MNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTI 279
            .|.||| :| ..|:|.:..:| :|...||  |:.:|           .::||.   .|..:||..
  Fly   318 TANWQGSLFKSYGMTPLQMMCGVNLFSSI--FTGAS-----------LSMQGG---FMDSLAFAT 366

  Fly   280 SCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIME-----------WEYMNLVTIMGFLI 333
            ....:.|..:.:::.|:.....:...:.|:...||.|||.           :.|.:.::::|.  
  Fly   367 EHPKFVFDMVVLSVCSAVGQLFIYHTIDVFGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGI-- 429

  Fly   334 LQMGIILYRQALFLDWYRAAVARWYRAR 361
              .|:::...|:||..|.....|..|.|
  Fly   430 --FGVLIVFVAIFLRVYCTQRLRAIRKR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
sllNP_001247153.1 UAA 144..444 CDD:285625 57/275 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.