DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35b2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_991198.1 Gene:slc35b2 / 402931 ZFINID:ZDB-GENE-050213-1 Length:435 Species:Danio rerio


Alignment Length:373 Identity:76/373 - (20%)
Similarity:124/373 - (33%) Gaps:144/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVFLSLIFVLSGTFNVLVVKWANQQQVI-----------GSDGKLHGFQHPVVFTLLMFLGEFLC 57
            |....|||..:| ..|..:.|...|:.:           ||..:....|      .|:|:...|.
Zfish   111 RQAFKLIFCAAG-LQVSYLTWGVLQERVMTRSYGSSEAEGSGERFRDSQ------FLVFMNRILA 168

  Fly    58 FAV-------FKVIRLISNRRGV------ISDLDSILSQ----DSSEFRPVSMLLPTLLDAAAS- 104
            ..|       ||     ..|.|.      .:.|.:|||.    ::.:|    :..||.:.|.|| 
Zfish   169 LTVSGLWCVLFK-----QPRHGAPMYKYSFASLSNILSSWCQYEALKF----ISFPTQVLAKASK 224

  Fly   105 ---ILLFTGL-------YLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLD 159
               ::|...:       |..|.|       |.||.:|:  :|||..:.|.:|...:.|.| |:|.
Zfish   225 VIPVMLMGKIVSRKSYEYWEYLT-------AVLISLGV--SMFLLSSSTDKHPSTVTTFS-GVLI 279

  Fly   160 IISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGI 224
            :...    :.:|..|..:.|                                |:...:.:..|.:
Zfish   280 LAGY----IVFDSFTSNWQD--------------------------------NLFKYKMSSVQMM 308

  Fly   225 FGLGITSMLAICMNFLP--------------SIDPFSCSSRAVFDDWGDLF---------AALQG 266
            ||:.:.|.|....:.|.              |...|.....:|...:|.||         ||:  
Zfish   309 FGVNLFSCLFTVGSLLEQGAFFNSLAFMTRHSEFAFHAVLLSVCSAFGQLFIFFTIAQFGAAV-- 371

  Fly   267 SISLIMTL---IAFTISCAMYN--------------FIGLYIAMYSSS 297
             .::||||   :|..:||.:|.              |:.|::.:|:.|
Zfish   372 -FTIIMTLRQALAILLSCFLYGHPVSLTGGLGVGVVFLALFLRIYARS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35b2NP_991198.1 UAA 115..417 CDD:285625 74/366 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.