DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Papst2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster


Alignment Length:335 Identity:69/335 - (20%)
Similarity:117/335 - (34%) Gaps:104/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LHGFQHPVVFTLLMF--LGEFLC---FAVFKVIRLISNRRGVISDLDSILSQDSS----EFRPVS 92
            |:|:...::||:..|  .|.||.   |..:....|:..|      |:.......|    |..|..
  Fly    75 LYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERR------LEGYRISGGSFWNIEPEPRC 133

  Fly    93 MLLPTLLDAAASILLFTGL------YLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIF 151
            :.:.|.|..||..|...||      ||.|.|.. :.:...||.|.:.|.:     :.|:.:    
  Fly   134 IPMRTYLILAALTLGTMGLSNSSLGYLNYPTQV-IFKCCKLIPVLVGSIL-----IQGKRY---- 188

  Fly   152 TISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVC-------EEKQLK 209
                ||||..:.....:.....||.    .|.:|.:..::...::.| ..:|       :||.::
  Fly   189 ----GLLDFAAATCMCIGLAWFTLA----DSQMTPNFNLLGVAMISG-ALLCDAAIGNVQEKAMR 244

  Fly   210 TSNVAPLQAAGWQGIFGLGITSMLAICM---NFLPS--------IDPFSCSSRAVFDDWGDLFAA 263
            .......:...:.  :|||...:..|.:   ||...        ::.|.         :|.|| :
  Fly   245 EFKAPSSEVVFYS--YGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFG---------YGFLF-S 297

  Fly   264 LQG--SISLIMTL-------IAFTISCA------MYNFI-------------------GLYIAMY 294
            |.|  .|..::.|       ||.|::.|      .::|:                   |:|:.:|
  Fly   298 LSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLGIYLNVY 362

  Fly   295 SSSANRLLAD 304
            |......|||
  Fly   363 SKRNKLTLAD 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Papst2NP_648954.1 UAA 61..364 CDD:285625 65/325 (20%)
EamA 219..362 CDD:279264 25/155 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.