DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35a5

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_005167880.1 Gene:slc35a5 / 368418 ZFINID:ZDB-GENE-030616-55 Length:463 Species:Danio rerio


Alignment Length:391 Identity:73/391 - (18%)
Similarity:140/391 - (35%) Gaps:112/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLIFVLSGTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISNRR 71
            |.|.||..||..:|::|::..::        :.:.:......||.....|.|.:...:|:|....
Zfish    63 LGLGFVTLGTSRILLLKFSGNEE--------NKYDYLPASVNLMAEAIKLVFCLVMSVRVIIREG 119

  Fly    72 GVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIF--VGIFS 134
            ....||.  .|..:|....:...:|..|....::::|      |..:: :....|::|  :.||:
Zfish   120 RSFKDLG--CSSGASFLSYLKWSVPAFLYFLDNLIIF------YVIAY-LQPAMAVLFSNIVIFT 175

  Fly   135 TMFLNHTLTGR-----HW-------LAIFTISCGLLDIISLDVHRVEYDLVTLP------YT--- 178
            |.||...:..|     .|       |:|.:::.|..|..::.||.:....::.|      ||   
Zfish   176 TAFLFRVVLKRRLSWVQWASLIILFLSIVSLTTGNGDQHAMAVHGLHPAHISTPSNSCLKYTHLH 240

  Fly   179 ----------------------DYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGW 221
                                  ...|...|.:|:::...:..|..:..||.||..... :::...
Zfish   241 QVHQSHNESYWSRELWDSQLIHKLNSFGLGYVLLLLQCFISALANIYNEKILKEGEQL-VESIFI 304

  Fly   222 QG----IFGLGITSM-----------------------LAICMNFLPSIDPFSCSSRAVFDDWGD 259
            |.    :|||...|:                       .::.:.|:.:....|.:....|.|  :
Zfish   305 QNSKLYLFGLVFNSLTLLLHADYRNLTLHCGILYGHNVFSVALGFVTAALGLSVAFILKFRD--N 367

  Fly   260 LFAALQGSISLIMTLIAFTISCAMYNF------------IGLYIAMYSSSANR-----LLADGLR 307
            :|..|.|.|:   |::...:|..:::|            :.|.|.:|.||..:     |..:.||
Zfish   368 MFHVLTGQIT---TVVVTALSFFLFDFQPSMDFFMQAPVVLLSIFIYHSSKMKDPEYALQQERLR 429

  Fly   308 V 308
            |
Zfish   430 V 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35a5XP_005167880.1 Nuc_sug_transp 72..411 CDD:282054 61/361 (17%)
EamA 138..411 CDD:304911 48/285 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.