DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and CG8195

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster


Alignment Length:295 Identity:63/295 - (21%)
Similarity:110/295 - (37%) Gaps:66/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHT---LTGRHWLAIFTISC 155
            ||..||..||:......|.:..|....::...:..|:...:.:|.:.|   ||....:|:.....
  Fly   180 LLFCLLWFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIG 244

  Fly   156 GLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVA--PLQA 218
            |::.|...|:|            |.| :..|.||.:.:...:....|..:::..|....  ||  
  Fly   245 GVVAITMNDLH------------DTK-MTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPL-- 294

  Fly   219 AGWQGIFG-LGITSMLAICMNF----LPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMT--LIA 276
                 .|| :|:.:||.:...|    ...|:.|...|              ||..:|:..  |:.
  Fly   295 -----FFGFVGLWNMLLLWPIFFILHFTKIETFELPS--------------QGQFALLFLNGLVG 340

  Fly   277 FTISCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIMEWE------YMNLVTIMGFLILQ 335
            ..:|.|::    |:....:||....||..|::....:|.::::.:      ||..:.|  |:.|.
  Fly   341 TVLSEALW----LWGCFLTSSLIGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPI--FVALV 399

  Fly   336 MGIILYR-------QALFLDWYRAAVARWYRARYV 363
            ...:|.|       ..||...|| .|.|.::...|
  Fly   400 FVSLLMRNDDSDPLMKLFRIVYR-KVCRCHKPSIV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
CG8195NP_611049.1 2A78 153..399 CDD:273359 53/258 (21%)
EamA 260..403 CDD:279264 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.