DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and SLC35B2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_835361.1 Gene:SLC35B2 / 347734 HGNCID:16872 Length:432 Species:Homo sapiens


Alignment Length:412 Identity:83/412 - (20%)
Similarity:132/412 - (32%) Gaps:131/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GEFLCFAVFKVIRLISNRRGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYAT 117
            |..|||.:.|.. :..|......::......:::|..|:...|..|..|       |||.::|.|
Human    69 GRGLCFPLVKAC-VFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCA-------TGLQVSYLT 125

  Fly   118 -----SFQMIR--GAALIFVGIFST-----MFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEY 170
                 ...|.|  ||.....|...|     :.:|..|.    |.:..:||.|............|
Human   126 WGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLA----LIVAGLSCVLCKQPRHGAPMYRY 186

  Fly   171 DLVTL-----PYTDYKSILTGDLLIIIAEILHGLQYVCEEKQL--KTSNVAPLQAAG-------- 220
            ...:|     .:..|::                |::|....|:  |.|.|.|:...|        
Human   187 SFASLSNVLSSWCQYEA----------------LKFVSFPTQVLAKASKVIPVMLMGKLVSRRSY 235

  Fly   221 --WQ----GIFGLGITSMLAICMNFLPSIDPFSCSSRA-------------VFD----DWGD-LF 261
              |:    .:..:|::.       ||.|..|...||.|             .||    :|.| ||
Human   236 EHWEYLTATLISIGVSM-------FLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALF 293

  Fly   262 AALQGSISLIMTL----IAFTISCAM--------YNFIG---------LYIAMYSSSANRLLADG 305
            |....|:.::..:    ..||:...:        ..|:|         |.:::.|:.....:...
Human   294 AYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYT 358

  Fly   306 LRVYFIWVFVIIMEWE-----------YMNLVTIMGFLILQMGIILYRQALFLDWYRAAVARWYR 359
            :..:...||.|||...           |.:.||::|.|    |:.:...||.|..|.       |
Human   359 IGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGL----GVAVVFAALLLRVYA-------R 412

  Fly   360 ARYVDLGTENAAAPNSRPADVI 381
            .|....|.:  |.|...|...:
Human   413 GRLKQRGKK--AVPVESPVQKV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
SLC35B2NP_835361.1 UAA 111..412 CDD:312076 68/345 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.