DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35a1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006238058.1 Gene:Slc35a1 / 313139 RGDID:1311359 Length:336 Species:Rattus norvegicus


Alignment Length:286 Identity:54/286 - (18%)
Similarity:104/286 - (36%) Gaps:90/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LMFLGEFLCFA-VFKV---IRLISNRRGVISDLDSILSQD--SSEFRPVSMLLPTLLDAAASILL 107
            |.|....:|.. |.|:   :.|::...|.:....:.||::  .|....:.:.:|:|:.|..:.:.
  Rat    41 LYFSTTAVCITEVIKLLISVGLLAKETGSLGRFKASLSENVLGSPKELLKLSVPSLVYAVQNNMA 105

  Fly   108 FTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDL 172
            |..|....|..:|:.....:....:.:.:.||.:|:...|:::|.: ||.:.::.....:....:
  Rat   106 FLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSKLQWISVFML-CGGVTLVQWKPAQATKVV 169

  Fly   173 VTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICM 237
            |.      ::.|.|...|.||.:..|...|..||.||:|:                 ||:     
  Rat   170 VA------QNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSD-----------------TSL----- 206

  Fly   238 NFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANRLL 302
                               |       ..:|.:.::.||.|::       |.|           |
  Rat   207 -------------------W-------VRNIQMYLSGIAVTLA-------GTY-----------L 227

  Fly   303 ADGLRV----------YFIWVFVIIM 318
            :||..:          |::| |||.:
  Rat   228 SDGAEIKEKGFFYGYTYYVW-FVIFL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35a1XP_006238058.1 Nuc_sug_transp 8..314 CDD:282054 54/286 (19%)
nst 90..313 CDD:129885 44/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.