DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Ugalt

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster


Alignment Length:309 Identity:58/309 - (18%)
Similarity:102/309 - (33%) Gaps:99/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LISNRRGVISDLDSILSQDSSEF----------RPVSML---LPTLLDAAASILLFTGLYLTYAT 117
            |:.|..|          :|:.:|          .|:..|   :|:|:....:.||:.......|.
  Fly    72 LVFNEEG----------KDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAA 126

  Fly   118 SFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPYTD--- 179
            ::|:.....::...:|:.:.|...|....|.|:..:..|::             ||.|..|:   
  Fly   127 TYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIV-------------LVQLAQTEGPT 178

  Fly   180 --------------------YKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGI 224
                                .::.:.|....:.|..|.|...:..||.||.:.::.     |...
  Fly   179 SGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISV-----WMRN 238

  Fly   225 FGLGITSMLAICMNFLPSIDPFSCSSRAVFDDWG-----DLF----AALQGSISLIM-------- 272
            ..|   |:|:|....|..   |......:||. |     |||    ..||....||:        
  Fly   239 VQL---SLLSIPFGLLTC---FVNDGSRIFDQ-GFFKGYDLFVWYLVLLQAGGGLIVAVVVKYAD 296

  Fly   273 -------TLIAFTISCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVF 314
                   |.:|..|||.    ..:||..::.:.......||.:..|:::
  Fly   297 NILKGFATSLAIIISCV----ASIYIFDFNLTLQFSFGAGLVIASIFLY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 58/309 (19%)
EamA 101..341 CDD:304911 51/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.