DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35c2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001101273.1 Gene:Slc35c2 / 311637 RGDID:1311250 Length:364 Species:Rattus norvegicus


Alignment Length:349 Identity:76/349 - (21%)
Similarity:135/349 - (38%) Gaps:68/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLSLIFVLSGTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISN 69
            |.|...|.:..||   ..||..:           .|..|:..|:|.....||..|:.:.:...|:
  Rat    21 VLLYYCFSIGITF---YNKWLTK-----------SFHFPLFMTMLHLAVIFLFSALSRALVQCSS 71

  Fly    70 RRGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFS 134
            .|..:     :||......|.....|.|.||...|...|  ||:| .:.:.|.:.:|::|:.|||
  Rat    72 HRARV-----VLSWTDYLRRVAPTALATALDVGLSNWSF--LYIT-VSLYTMTKSSAVLFILIFS 128

  Fly   135 TMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGL 199
            .:|....|.....|.:..|:.||.             :.|...|.:.  :.|..|::.|..:.|:
  Rat   129 LIFKLEELRAALVLVVLLIAGGLF-------------MFTYKSTQFN--VEGFALVLGASFIGGI 178

  Fly   200 QYVCEEKQLKTSNVA---PLQAA-GWQGIFGLGITSMLAICMNFLPSIDPFSCSSRAV-FDDWGD 259
            ::...:..|:.:::.   |:... ..|.:..||:..:.|:....     ..|.|.:.. |.|.|.
  Rat   179 RWTLTQMLLQKADLGLQNPIDTMFHLQPLMFLGLFPLFAVFEGL-----HLSTSEKIFRFQDPGL 238

  Fly   260 LFAALQGSISLIMTLIAFTISCAMYNFIG------LYIA-MYSSSANRLLADGLRVYFIWVFVII 317
            |...| ||: |:..::||.:..:.:..:.      |.|| ::......|||    .:.:...:.:
  Rat   239 LLWVL-GSL-LLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLA----AHLLGDQISL 297

  Fly   318 MEWEYMNLVTIMGFLILQMGIILY 341
            :.|        :||.:...||.|:
  Rat   298 LNW--------LGFALCLSGISLH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35c2NP_001101273.1 TPT 16..313 CDD:281186 75/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.