DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35f2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001382663.1 Gene:Slc35f2 / 300713 RGDID:1311242 Length:375 Species:Rattus norvegicus


Alignment Length:297 Identity:63/297 - (21%)
Similarity:126/297 - (42%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LLMFLGEFLCFAVFKVIRLISNRRGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLY 112
            |..|:...|.|.|:.|:....      |..|::|.....::...::|  .|.|..|:.|:.....
  Rat    74 LQSFINYCLLFLVYTVMLAFQ------SGSDNLLEILRRKWWKYTLL--GLADVEANYLIVRAYQ 130

  Fly   113 LTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPY 177
            .|..||.|::....:..:...|...|.......|::|:|....|:..::..|:.....|      
  Rat   131 YTTLTSVQLLDCFGIPVLMALSWFILRARYKVIHFIAVFVCLLGVGTMVGADILAGRED------ 189

  Fly   178 TDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPS 242
            .....:|.||:|:::...|:.:..||||..:|  .::..:..|..|:||..|:.:..:.:.:.  
  Rat   190 NSGSDVLIGDILVLLGASLYAVSNVCEEYIVK--KLSRQEFLGMVGLFGTIISGIQLLIVEYK-- 250

  Fly   243 IDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSA---NRLLAD 304
                  ....:..||         .|:|:....|..:.| :|:|:.|.:.:.|:::   ..|.||
  Rat   251 ------DIARIQWDW---------KIALLFVAFALCMFC-LYSFMPLVMKVTSATSVNLGILTAD 299

  Fly   305 GLRVYFIWVFVIIMEWEYMNLVTIMGFLILQMGIILY 341
               :|.::..:.:.|:::..|. |:.|.::.:|.|||
  Rat   300 ---LYSLFFGLFLFEYKFSGLY-ILSFTVIMVGFILY 332



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.