DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35f5

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006249733.1 Gene:Slc35f5 / 288993 RGDID:1308125 Length:546 Species:Rattus norvegicus


Alignment Length:311 Identity:58/311 - (18%)
Similarity:104/311 - (33%) Gaps:107/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVF---------------KVIRLISNRRGVIS 75
            :|:.::.:.|||       ..|.:..:..|.||..|               .::.::|:..|:.:
  Rat   247 DQESILKTVGKL-------TATQVAKISFFFCFVWFLANLSYQEALSDTQVAIVNILSSTSGLFT 304

  Fly    76 -DLDSILSQDSSEFRPVSMLLPTLL-------------------DAAASILLFTGLYLTYATSFQ 120
             .|.::...:|.:...:|.||..:|                   |...||....|. :.||....
  Rat   305 LILAAVFPSNSGDRFTLSKLLAVILSIGGVVLVNLSGSEKSAGRDTIGSIWSLAGA-MFYAVYIV 368

  Fly   121 MIRGAA-----------LIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVT 174
            ||:...           ..|||:|:.:.|        |...|                      .
  Rat   369 MIKRKVDREDKLDIPMFFGFVGLFNLLLL--------WPGFF----------------------L 403

  Fly   175 LPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITS----MLAI 235
            |.||.::.....:.::::..|::||......:.|            |  ::|..:||    .||:
  Rat   404 LHYTGFEDFEFPNKVVLLCIIINGLIGTVLSEFL------------W--LWGCFLTSSLIGTLAL 454

  Fly   236 CMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNF 286
            .:....||....|..:..| .|  ||.|  |:|.:..:....|:.|...|:
  Rat   455 SLTIPLSIIADMCMQKVQF-SW--LFFA--GAIPVFFSFFIVTLLCHYNNW 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35f5XP_006249733.1 EamA <251..339 CDD:279264 16/94 (17%)
RhaT <268..493 CDD:223769 50/274 (18%)
EamA 350..493 CDD:279264 37/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.