DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35a4

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_671481.2 Gene:Slc35a4 / 257647 RGDID:628792 Length:324 Species:Rattus norvegicus


Alignment Length:371 Identity:68/371 - (18%)
Similarity:106/371 - (28%) Gaps:159/371 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DGKLHGFQHP--VVFTLLMFLGEFL--CFAVFKVIRLISNRRGVISDLDSILSQDSSEFRPVSML 94
            ||.:.|...|  ..:||::||...:  ..|.|..:..:..|               ..|||.|.:
  Rat     5 DGGMPGLARPKQARWTLMLFLSTAMYGAHAPFLALCHVDGR---------------VPFRPSSAV 54

  Fly    95 LPT----LLDAAASILL-----------------FTGLYLTYA---------------TSFQMIR 123
            |.|    ||..|.|:|:                 |....|.|.               :::|::.
  Rat    55 LLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLS 119

  Fly   124 GAALIFVGIFSTMFLNHTLTGRHWLAIFTI--------SCGL--------------------LDI 160
            ...:....:...:.|.|.|:.|..||:..:        |.|.                    |.|
  Rat   120 NLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQEPGNTLPGPRSAAGARPMPLHI 184

  Fly   161 ISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIF 225
            ..|                      |.||:|:..::.||..|..|..:|...: ||   ..|.:|
  Rat   185 TPL----------------------GLLLLILYCLISGLSSVYTELIMKRQRL-PL---ALQNLF 223

  Fly   226 --------GLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLI------- 275
                    .||:.:.......||..           |..|..|....|....|:|:.:       
  Rat   224 LYTFGVILNLGLYAGSGPGPGFLEG-----------FSGWAVLVVLNQAVNGLLMSAVMKHGSSI 277

  Fly   276 --AFTISCAMY----------------------NFIGLYIAMYSSS 297
              .|.:||::.                      ..|||.:.:|..|
  Rat   278 TRLFIVSCSLVVNAVLSAVLLQLQLTATFFLAALLIGLAVCLYYGS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35a4NP_671481.2 Nuc_sug_transp <83..320 CDD:398009 44/273 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.