Sequence 1: | NP_001303462.1 | Gene: | Tango9 / 41450 | FlyBaseID: | FBgn0260744 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_671481.2 | Gene: | Slc35a4 / 257647 | RGDID: | 628792 | Length: | 324 | Species: | Rattus norvegicus |
Alignment Length: | 371 | Identity: | 68/371 - (18%) |
---|---|---|---|
Similarity: | 106/371 - (28%) | Gaps: | 159/371 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 DGKLHGFQHP--VVFTLLMFLGEFL--CFAVFKVIRLISNRRGVISDLDSILSQDSSEFRPVSML 94
Fly 95 LPT----LLDAAASILL-----------------FTGLYLTYA---------------TSFQMIR 123
Fly 124 GAALIFVGIFSTMFLNHTLTGRHWLAIFTI--------SCGL--------------------LDI 160
Fly 161 ISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIF 225
Fly 226 --------GLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLI------- 275
Fly 276 --AFTISCAMY----------------------NFIGLYIAMYSSS 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango9 | NP_001303462.1 | None | |||
Slc35a4 | NP_671481.2 | Nuc_sug_transp | <83..320 | CDD:398009 | 44/273 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |